PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009765928.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family FAR1
Protein Properties Length: 440aa    MW: 50051.7 Da    PI: 9.6378
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009765928.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR182.76.3e-2631118290
            FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                     +Y eYA  +GFsvrk++ +k+k +g +t+r+f+C keg+r+++k+  ++ +++r+etrtgC a++ +++++dgk+++t+++++HnH+l 
  XP_009765928.1  31 CYIEYAAALGFSVRKEYANKNKVQGYVTSRKFTCHKEGYRSKDKRG-QTVQKHRKETRTGCLAHIIISRQSDGKFRITSFQEKHNHPLD 118
                     799****************************************999.99999***********************************97 PP

2FAR184.32e-26175262290
            FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                     +YneYA  +GFs rk++ +ksk +g +t+r+f+C keg+r+++k++ ++ +++r+etrtgC a++ ++++++g++++t++e++HnH+l 
  XP_009765928.1 175 WYNEYAAAMGFSARKEYANKSKVQGYVTSRKFTCHKEGYRSKDKRD-RTVQKHRKETRTGCLAHIIISRQSNGTFRITSFEEKHNHPLD 262
                     7******************************************999.99999***********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.3E-2331119IPR004330FAR1 DNA binding domain
PfamPF031011.0E-23175263IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MEITSSESQG GFNVPIKLGM EFDSDEQAYE CYIEYAAALG FSVRKEYANK NKVQGYVTSR  60
KFTCHKEGYR SKDKRGQTVQ KHRKETRTGC LAHIIISRQS DGKFRITSFQ EKHNHPLDPS  120
SLSHILPSQR KIKVAQAHEV TARFMEITYS ESQGGFNVPI KLGMEFDSDE HAYEWYNEYA  180
AAMGFSARKE YANKSKVQGY VTSRKFTCHK EGYRSKDKRD RTVQKHRKET RTGCLAHIII  240
SRQSNGTFRI TSFEEKHNHP LDPSLSDMLP SERKIKVAQA HKVSVRYKHL CEIFAQISSE  300
ASESKEGYEL AAKCANELVA KLKHVKKRNE SHEDSAPSKS IENELNETIF IDNTNATKLT  360
GLKRKQPTHR SNTRTMSFME MTKSKNNTSL LKSPQCQTDK KLDHLPSLLS CQVTCPSLSD  420
ASMTMGVPEG SCLKDHPMKV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009765928.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 7-like
RefseqXP_009765927.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 7-like
RefseqXP_016460557.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 7-like isoform X2
TrEMBLA0A0D2RWN95e-87A0A0D2RWN9_G
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06250.16e-31FAR1-related sequence 7